Dataset for protein Bcl-xL of organism Astatotilapia calliptera

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8P0F1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Astatotilapia calliptera GN=BCL2L1 (length=233 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTD
LDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
© 1998-2019