Dataset for protein Bcl-2 of organism Astatotilapia calliptera

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8QVM8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Astatotilapia calliptera GN=BCL-2 (length=228 residues).
MENEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019