Dataset for protein Unclassified of organism Armadillidium vulgare iridescent virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A068QLP8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Viruses] Armadillidium vulgare iridescent virus (length=153 residues).
MDEIPKITKCVVNPSLITDKEGLRKDLAVAVLYLIKEVLKFSNKKDVNGADKLCQDLLAQTPNVNFETSVYQVFEELFAE
GISWYKIATLFAFCHILATKTTVSLVESSLRSYISDYLFKWVSENGGWNGLIILANKCSNNYCIAPDQNNEGN
© 1998-2019