Dataset for protein Mcl-1 of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A2K5C7L5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=238 residues).
MFGLQRNALIGLNLYCEWAGLGTGSGGTTPPGGRLLATEKEASAQREVGGGEAGVVIGGSAGASPSAALTPDARGSCGRC
WFFAPTRRAAPLEEMEAPAADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEPGNDSSTDGSLPSTPPTSLEIISRYLR
EQATGAKDTKPMDRSGAASRKALETLRRVGDGVQRNHETAFQVLPCRRPRRWHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A2K5CFH3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=263 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAGASPPAALVPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFG
>gnl|bcl2dbpro|A0A2K5CFH3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=352 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAGASPPAALVPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLALSLIHI
>gnl|bcl2dbpro|A0A2K5CFH3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=199 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSLIHI
>gnl|bcl2dbpro|A0A2K5DMS4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=163 residues).
MFGFQVVIRLNLYCGAIPPGPRLLATGAKDTKPMGRSEAANSKALETLRGVGEGVPRNHEMALQGMLRNLDNKNEDNVKS
FYGVTNWGRIVTLSSFGAFVAKHLKTINQESCIEPLAESIRYSRWDGFVEFFRVEDLEGGIRNGLLAFAGVAGVGTDLAY
LIR
>gnl|bcl2dbpro|A0A2K5EPY9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=132 residues).
SQSYNNLKITTCMLRKLDIKNKDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5EPY9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=134 residues).
NASCSRPACFSSPGMLRKLDIKNKDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITD
VLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLIR
© 1998-2019