Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bcl2dbpro|A0A2K5C7L5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=238 residues).
MFGLQRNALIGLNLYCEWAGLGTGSGGTTPPGGRLLATEKEASAQREVGGGEAGVVIGGSAGASPSAALTPDARGSCGRC
WFFAPTRRAAPLEEMEAPAADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEPGNDSSTDGSLPSTPPTSLEIISRYLR
EQATGAKDTKPMDRSGAASRKALETLRRVGDGVQRNHETAFQVLPCRRPRRWHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A2K5CFH3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=263 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAGASPPAALVPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFG
>gnl|bcl2dbpro|A0A2K5CFH3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=352 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSAGASPPAALVPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLALSLIHI
>gnl|bcl2dbpro|A0A2K5CFH3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=199 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSLIHI
>gnl|bcl2dbpro|A0A2K5CWZ4_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L2 (length=216 residues).
MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5CWZ4_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L2 (length=204 residues).
HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLH
VTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTA
LYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5CWZ4_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5D2I1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2A1 (length=175 residues).
MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWISQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYY
>gnl|bcl2dbpro|A0A2K5D2I1_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2A1 (length=163 residues).
MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWISQNGGWAKWHSLLLVLVESVAQKERK
MAL
>gnl|bcl2dbpro|A0A2K5DMS4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=163 residues).
MFGFQVVIRLNLYCGAIPPGPRLLATGAKDTKPMGRSEAANSKALETLRGVGEGVPRNHEMALQGMLRNLDNKNEDNVKS
FYGVTNWGRIVTLSSFGAFVAKHLKTINQESCIEPLAESIRYSRWDGFVEFFRVEDLEGGIRNGLLAFAGVAGVGTDLAY
LIR
>gnl|bcl2dbpro|A0A2K5EB04_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Aotus nancymaae GN=BCL-2 (length=240 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVSRTSPPPPPAAPAA
AATGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
ESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2K5EBP4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L1 (length=146 residues).
MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIA
AWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5EBP4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5EPY9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=132 residues).
SQSYNNLKITTCMLRKLDIKNKDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5EPY9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aotus nancymaae GN=MCL-1 (length=134 residues).
NASCSRPACFSSPGMLRKLDIKNKDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITD
VLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5F974_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L10 (length=213 residues).
MADPLRQRTERLVADYLEYCSQEPGTPESPPSTAEAAVLRAMAAGVRKLYRSFFSAYLGYPGNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGWVSMRRGT
RASRVAGNIGWLLLLLQDLLLAGIMEKTAGPGFPVMVVNSSIHLLLDTIIRSF
© 1998-2019