Dataset for protein Bfl1 of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5D2I1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2A1 (length=175 residues).
MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWISQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYY
>gnl|bcl2dbpro|A0A2K5D2I1_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2A1 (length=163 residues).
MTDCEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSIDNARMIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWISQNGGWAKWHSLLLVLVESVAQKERK
MAL
© 1998-2019