Dataset for protein Mcl-1 of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|R4GAJ0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=311 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWHNCV
>gnl|bcl2dbpro|R4GAJ0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=329 residues).
MAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQ
PKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGS
KGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFRDGIINW
GRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWEGFVQFFHVEDIEGGIRNVLVAFASVAGI
GAGLAYMIR
© 1998-2019