Dataset for protein BCL-2-like of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|H9GHK7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L1 (length=209 residues).
MSSSNRALVVDFLSYKLSQRGHSWHEIEMESGEEAMEPANETGNTLNGSPSWHPSPSHVINGASEHPELLEEEEEENPRV
DVSQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMQGLVV
RIASWMTTYLTEHLDPWIQENGGWKSKGGQIISVIYTHHSEVCLNTYID
>gnl|bcl2dbpro|H9GPE7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anolis carolinensis GN=BCL-2 (length=170 residues).
MAHPGIRGYDNREIVLRYIHYKLSQKGYDWVASGDRGKSASLSPELLNSDPVSTNAPREEPDPVPQVVHTTLRQAGDEFS
RRYRRDFAQMSGQLHLTPSTARSRFVAVVEELFQDGVNWGRIVAFFEFGGMLCVESVSREMSPLVDNIATWMTEYLNQYL
RNWIQENGGW
>gnl|bcl2dbpro|R4GAJ0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=311 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWHNCV
>gnl|bcl2dbpro|R4GAJ0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=329 residues).
MAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQ
PKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGS
KGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFRDGIINW
GRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWEGFVQFFHVEDIEGGIRNVLVAFASVAGI
GAGLAYMIR
© 1998-2019