Dataset for protein Bcl-2 of organism Anolis carolinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H9GPE7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anolis carolinensis GN=BCL-2 (length=170 residues).
MAHPGIRGYDNREIVLRYIHYKLSQKGYDWVASGDRGKSASLSPELLNSDPVSTNAPREEPDPVPQVVHTTLRQAGDEFS
RRYRRDFAQMSGQLHLTPSTARSRFVAVVEELFQDGVNWGRIVAFFEFGGMLCVESVSREMSPLVDNIATWMTEYLNQYL
RNWIQENGGW
© 1998-2019