Dataset for protein Mcl-1 of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A493U0E8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=MCL-1 (length=325 residues).
GGWGTESWRNTSWPSKGPARSDHLGSVLWKSEASSQGPARIDHFGSVPWNSEASPRGVVGTAHFGSVLWNSEASPWGWGG
TDHFGAVFPEPSSGIFSRPARTNPLGSAPRGRGGDLTILGWFHPTQKRAPEPAGRRDAAPPAAGCCTFKKCKRFRAGPHP
FPHHPAGRDFWGFTTPGQIFGVLARKPHSGEQGGVTVEDLGRSLGMLRKLEIKKEEDLQAVGEVAAHLFSDGVTNWGRVV
TLISFGAFVARHLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASL
AYMIR
© 1998-2019