Dataset for protein Bfl1 of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A493SSZ7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL2A1 (length=172 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDISSVDVAKRIFNGVMDEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DLFVAVFSLFRE
© 1998-2019