Dataset for protein Bcl2l10 of organism Anabas testudineus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1IAB0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L10 (length=243 residues).
MFQLSWGLFLLEAESADKCADAEGKLRVHRGSPSAVRMCREQTDIAGRKMSCGLWKDTLALAEDYLSLCCTSPWPAPPPP
SESAAAMRRLAQDMEKQHQVRFHSLAQTFLKQCGPDPCSSLRKVMEELVGDGHMNWGRVVSLFTFTGVLARQMLEQKDKK
PGLDLGKGQELGQEPGQCRGLAETIADYLGEEKKDWLLENDGWEGFCKFSCSAREVSQDSSMKRALFAAAGVGLAGLTFL
LVR
© 1998-2019