Dataset for protein Bcl-xL of organism Anabas testudineus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q1GZ93_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSQLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1GZ93_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSQLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1GZ93_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSQLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1JZ46_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=219 residues).
MEEMSNSNRELVEFFIMYKLSQRNHPASLLRPDDTGGVGDRPNSAAANGLPVSRSGELGNSSPPCKSMEAVKTALRDSAD
EFELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECVEKNMSELVSRIADWMTMYLD
EHISPWIQSQGGWDCFAEIFGQDAAAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR
>gnl|bcl2dbpro|A0A3Q1JZ46_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L1 (length=219 residues).
MEEMSNSNRELVEFFIMYKLSQRNHPASLLRPDDTGGVGDRPNSAAANGLPVSRSGELGNSSPPCKSMEAVKTALRDSAD
EFELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDGVNWGRIVGLFAFGGVLCVECVEKNMSELVSRIADWMTMYLD
EHISPWIQSQGGWDCFAEIFGQDAAAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR
© 1998-2019