Dataset for protein Bcl-2 of organism Anabas testudineus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1I5N1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYAWGFHDAQDEDAANNGSAVPPPPTLVRRCREASTGPDSDSIPQHCRRLPPSDPHAAL
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEEMTPQVNN
IAEWMTEYLNGPLHSWIQDNGGWDAFVDLYDRQRESVFSCSWSSIKTVFGLAALGAASLTIGAYLAQK
© 1998-2019