Dataset for protein Unclassified of organism Amphiprion percula

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8TSD0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphiprion percula (length=231 residues).
MILYKVLGLYLLSDSSSCLRIIIATTLSNSPSVLSQVKTSSSFSDVKYQGGPSRSQNRDEALNKETRRLVKRILGESTGL
LESSSEENEALSTMKRTVRRVLQKYRNVYDGMIEKLPVDGRGDKVTSVSAVACAVFADGAANWGRIVSLVAFGVVLCQNV
NKKERGRLTLVESVGEEISTYLLTDQKDWLLKNNSWVGFVEFFAEPRHELRDAFVFIAGFAGIIWALIYFV
>gnl|bcl2dbpro|A0A3P8UH71_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphiprion percula (length=212 residues).
GAMAAAYSSRDIVEDYLHDKLVSRGVAWPRPLPGRTPRRRGTADDVLLGEEAVCVDPGLAPPPLQAALCTAGDELARCYH
GDLWAQVSVRLCRDGGGVVQRHTLTAVSRELFRDGVNWGRIITMMELGGALSAEAAEAGLTCQVDDIAGWMEDSLDSPSK
LIKRFVSLISQDAFLQLYESRPPVTSWSLRTVVGLVVLGAAGITLGALFSQK
© 1998-2019