Dataset for protein Unclassified of organism Amphiprion ocellaris

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q1B7Q9_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphiprion ocellaris (length=211 residues).
GAMAAAYSSRDIVEDYLQDKLVSRGVAWPCPPPGRTPRRRGTAEDVLLGEEAVCVDPGLAPPPLQAALHTAGDKLARCYH
GDLWAQVSVRLCRDGGGVVQRHSLTAVSRELFRDGVNWGRIVTMMELGGALSAEAAEAGLTCQVDDIAGWMEDSLDSPPL
RGWIQDNGGWDAFLQLYESRPPVTSWSLRTVVGLVVLGAAGITLGALFSQK
>gnl|bcl2dbpro|A0A3Q1B7Q9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphiprion ocellaris (length=216 residues).
MKSSSVSRVKVEEENIQQVAANTHTQRYPLTHSLSLSLSLSLSLSLSLSEGAWPPAVFGAHPGLAPPPLQAALHTAGDKL
ARCYHGDLWAQVSVRLCRDGGGVVQRHSLTAVSRELFRDGVNWGRIVTMMELGGALSAEAAEAGLTCQVDDIAGWMEDSL
DSPPLRGWIQDNGGWDAFLQLYESRPPVTSWSLRTVVGLVVLGAAGITLGALFSQK
>gnl|bcl2dbpro|A0A3Q1BPF0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphiprion ocellaris (length=231 residues).
MILYKVLGLYLLSDSSSCLRIIIATTLSNSPSVLSQVKTSSSFSDAKYQGGPSRSQNRDEALNKETRQLVKRFLGESTGL
LESSSEENEALSTMKRTVRRVLQKYRNVYDGMIEKLPVDGRGDKVTSVSAVACAVFADGAANWGRIVSLVAFGVVLCQNV
NKNERGRLTLVESVGEEISTYLLTDQKDWLLKNNSWVGFVEFFAEPRHELRDAFVFIAGFAGIIWALIYFV
© 1998-2019