Dataset for protein Unclassified of organism Amphimedon queenslandica

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A1X7U9C1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=229 residues).
MAVALQPRHVTATSPVPEERRKKDTTWTPSSTQASNILANTDFAYQTKEIIHETFYGLLLEQGLKLNGGHVEPIFTSETN
RKVYSSLMGACKQFLRLHSDQIRRDMEQLDISETALCVTFHSTMHSMFSDCINWGRIVALISFAVLVAYKAHKTSRHVVE
SIEGWLITFICQNLSQFIMKQKGWASVPDRFSSNKIGGDIVDAKNGGGSWLALAAVGVGAALVTAFLSK
>gnl|bcl2dbpro|A0A1X7UKJ6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=234 residues).
MAVALQPRHLTSTSPVPERRKKDAKWTPSSTQGAHASNILANTDFVHQTKEIIHEVFYALLLEQGVKLNGYTTGHVEPIF
SSETNRKVYNSLMGACRQFLRLHSDQIRRDVEKLDISETTLCITFHSTMHSIFSDCVNWGRIIALISFAVLVAYKAHKTS
RHVVESIEGWLITFICQNLSQFIMKQKGWASVPDRFSSDKIGGDTVDAKNGGGSWLALAAVGVGAALVTAFLSR
>gnl|bcl2dbpro|A0A1X7UUJ1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=214 residues).
MALVVNPAPVQHQYHHKNSPKRRGSPVQDDKFYEETRNLITACIESASGKEPLSVKLSEEALRIVGMVQQTLKADEIFFR
KLCEELELTATNLFSKLMDVWGGMFSDGQVNIGRLLALLAFCQCVTVYCRSVGLPSIESSVPHWASIFISTTHLKDWITN
RGGWDAISKELMLRTSATNSSTSSRTASNGGWLQWGVSGIALAISVFDALHNSS
>gnl|bcl2dbpro|A0A1X7V1Y6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphimedon queenslandica (length=229 residues).
MEVLSPSVTRQKGVHHHNLAMASTSSSIPSDSRIGRVVKRTVRSLLEKDGYRQEQALSLIDPVGQFGEDELLLVERIVNL
VLRLVDDPRQSRRITVADLEQNDWPLQPDNVHSEFKTVATQIFSDDINWGRIVSFLSFSSTYILFSMRRGMPESIVQSVC
GWTTSFMERELRSWFQSHSWEEFLSYGESILKARQRNGESERPIWQNLATIGAIGIGAAVLFSLRSSFS
>gnl|bcl2dbpro|A0A1X7VN87_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=241 residues).
MNIITRALYKKKQIRQDLHLKAKKPSSKEKKNQKPIMSSVISQQEEKQSTSSAGGVKALTQSYIIEQLRQNGYKSLAASL
SKDQLTISEEMHKIVKRISNQLAQEKKEQMEDICFELQLTKETLTETFNGISQELFKDGIKWGRIVTFIAFSGAMAVYCA
QNSLGDQVSDVIRQTGSFIQDNLHQWILNNDGWCGFVRHFDEQDINLNFFVPAFFIGLGMTALAVAGSFLAFKRKYTGGL
L
© 1998-2019