Dataset for protein Unclassified of organism Amphilophus citrinellus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q0S1A1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Amphilophus citrinellus (length=197 residues).
MQYSNRELVEFFISYKLSQRNHPTPLLRPSDAGQRTEEDQANSWPAHHGVEAVKSALIDSGEQFGFLFTQSFQDVASHLS
ITPDTAQQCFKNVMDELFRDGINWGRVIGLFVFGSAMCADCVENNMSEMVPHIADWMTVYLDEHINLWIQRHGGWDRFTE
IFGKGMSARRSRESLKRWLFVGVALVTGLLVGMLMAD
>gnl|bcl2dbpro|A0A3Q0SHK0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphilophus citrinellus (length=194 residues).
GAMAAAYSSRDIVEDYLHYKLLCRGVAWPSAPPPHRPDPRVAPPRLQIVLRSAGDELERLYGAELSAQVSVLRLRGDGGD
AARLRNMTAIREELFRDGVNWGRIVTMMELGGALSAEVAMTGDTGHVDDIAGWMEESLDSPLLQRWIQDNGGWDAFMDLY
ESRPADSFWALSTMFGLVVLGAAVVILGFLFSQK
© 1998-2019