Dataset for protein Mcl-1 of organism Amphilophus citrinellus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q0RA11_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=MCL-1 (length=269 residues).
MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYGSGNSSPQDATGTPKDSNGTPKRPNNLGVVSTNGYAPKNITDDVED
GSLPSTPEFHSDSESDEALERETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMVNKLSLDERGE
DVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRV
ADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q0RA11_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=MCL-1 (length=227 residues).
SLPFTSPDSNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALERETKSLITSFFRDFTGLSQRRW
KESEALKTMKRVVADVLEKHRYAYNGMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGR
DNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q0RA11_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=MCL-1 (length=142 residues).
MPERNGSAISTQLGLHPRISGMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVE
LVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR
© 1998-2019