Dataset for protein BCL-2-like of organism Amphilophus citrinellus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3Q0RA11_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=MCL-1 (length=269 residues).
MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYGSGNSSPQDATGTPKDSNGTPKRPNNLGVVSTNGYAPKNITDDVED
GSLPSTPEFHSDSESDEALERETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMVNKLSLDERGE
DVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRV
ADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q0RA11_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=MCL-1 (length=227 residues).
SLPFTSPDSNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALERETKSLITSFFRDFTGLSQRRW
KESEALKTMKRVVADVLEKHRYAYNGMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGR
DNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q0RA11_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=MCL-1 (length=142 residues).
MPERNGSAISTQLGLHPRISGMVNKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVE
LVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q0RTF8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphilophus citrinellus GN=BCL2L1 (length=232 residues).
MSQNRELVLFYITYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTNL
DAVKEALRDTANEFELRYARAFNDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A3Q0S5Z7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphilophus citrinellus GN=BCL-2 (length=228 residues).
MANEYNRNIVEKYICHKLSKRGYAWGFDGVQDEDAANNGSINDPPPTLVRRCREPSNGPDGESNTHLCRRLPQSDPHADI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMTSQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYGRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q0S9R1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Amphilophus citrinellus GN=BCL2L10 (length=191 residues).
MVPGLWKETLGLAEDYLSLCCTSPHQVPPPPSESAAAMRRLGQDIERQHQARFDNLAQTFLRHCGPDHCSSLRKVMEELV
GDGHLNWGRVVSLFAFTGVLARKRLEQKPGLDPGQQQELGQEPISCRELAETIADYLGEEKKDWLLDNDGWEGFCKYSRS
AREVSQDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2019