Dataset for protein Bcl-2 of organism Amphilophus citrinellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q0S5Z7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amphilophus citrinellus GN=BCL-2 (length=228 residues).
MANEYNRNIVEKYICHKLSKRGYAWGFDGVQDEDAANNGSINDPPPTLVRRCREPSNGPDGESNTHLCRRLPQSDPHADI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMTSQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYGRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019