Dataset for protein Mcl-1 of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G1L3M8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=334 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPXGAEGPDVTATPPRL
LFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYR
QSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSD
GVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFA
GVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1L3M8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=347 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPAXXXXXXXXXXXXXG
AEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPST
PPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDV
KSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVED
LEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019