Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|G1L3M8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=334 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPXGAEGPDVTATPPRL
LFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYR
QSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSD
GVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFA
GVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1L3M8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=347 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPAXXXXXXXXXXXXXG
AEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPST
PPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDV
KSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVED
LEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1LID1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL-2 (length=183 residues).
PHPAASPRPFVRRWQVAPPSAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEE
LFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLS
LKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G1LID1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL-2 (length=163 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGAR
PLE
>gnl|bcl2dbpro|G1LKR4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L10 (length=193 residues).
MADALRGTARLLTDYLEYCAREPGTPARAPSTPEAAVLRSVAAQVQQRHERFLSDYRGYAGGNRVELVAQVEREILAHPQ
PLSWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEWEAGVRQDCRHLVDFLCNRLTGQHRAWLEAHDGWDGFCLFF
TPMLPSSWKRLLAQALLSCFTAVILIYFWKRLL
>gnl|bcl2dbpro|G1LMC3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L2 (length=209 residues).
PYIHASLSSLTLTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDL
AAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW
AEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019