Dataset for protein Bcl-w of organism Ailuropoda melanoleuca

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1LMC3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L2 (length=209 residues).
PYIHASLSSLTLTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDL
AAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW
AEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019