Dataset for protein Bcl-2 of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G1LID1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL-2 (length=183 residues).
PHPAASPRPFVRRWQVAPPSAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEE
LFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLS
LKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G1LID1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL-2 (length=163 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGAR
PLE
© 1998-2019