Dataset for protein Unclassified of organism Acropora millepora

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|B7SB93_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Acropora millepora (length=186 residues).
MVHNNDRLRSFNTIVKDYVGYKLRQKNIFLDGYNVNESPSAAACHLRRVADELIEENRQLFDSMCDQLHLTHASTYATFV
GIADEIFQTGKNWGRIVAFLAFGATLAVYCVQKEDLAELLDNIIEWLSLYMEQNLGQWINENGGWEGFIQFFKKEDGSPG
NGRNGGWRIAAVAGLGIGALLMLACR
>gnl|bcl2dbpro|B7SB94_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Acropora millepora (length=211 residues).
MAGATAALNNEDLSPTLSTSELSRYDKDIVNDGYSLTVDYVSYRLRNKFEQNKLSGLPRKFLIPQSPISASSSNLRKLAT
LMEAEHPDLFESLCTTLGITPNTAHPTFVGVAQEIFQAGINWGRIVALFTFGGVVAHHFVEIQRLEMVQRIVEWIADFIE
HNLLTWIRENGGWDGFVAHFSDSSQSQFTWKSLVTVGSICAAGLTLLALNK
© 1998-2019