Dataset for protein BCL-2-like of organism Acanthochromis polyacanthus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3Q1EQB9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=MCL-1 (length=279 residues).
MNMIPTKRTTLMNCLIFPQNGVVEGPMHYGSGDSSPQISVASSIDPQNGNLGSSDTPKRPKNLGVNGYAPKSLRQDSDSM
EDGSLPCTPELQSDSETDVSSCPTGDELLENDTRQLIRRFLRDFTGLSKPRWNESKALSTMKRVVDDVLDKHRYSYNGMI
NKLSLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDLVSQEISTYLLSEQRDWLVKNNS
WDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q1EQB9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=MCL-1 (length=383 residues).
MNMIPTKRTTLMNCLIFPQNGVVEGPMHYGSGDSSPQISVASSIDPQNGNLGSSDTPKRPKNLGVNGYAPKSLRQDSDSM
EDGSLPCTPELQSDSETDVSSCPTGDELLENDTRQLIRRFLRDFTGLSKPRWNESKALSTMKRVVDDVLDKHRYSYNGMI
NKLSLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFGAVVCQYLKERGRENCVDLVSQEISTYLLSEQRDWLVKNNS
WDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIRLESKFGETQRTGRGAGGKRWIQGGRRKPQERNRRRHDACRD
RGRGQGNRQNWRVPRRGNQEGHGAGRGPRRKQGDRLGRSGPDSGILQERRTEKKTLVSEILVT
>gnl|bcl2dbpro|A0A3Q1EVP6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L1 (length=208 residues).
MSCSNRELVEFFISYKLSQRNYPMSLLRPEDAGGRTDGDKASSASSNGLLVNNRDGIEAVKSTLKDAADEFELLFTQTFS
DLSSQIDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVEKNMSELVPRIADWMTMYLDEHISPWIQSQG
DWECFAEIFGQNAAAEARRSRDTLKRWLLAGGVLLMGVLAGVLIAKKQ
>gnl|bcl2dbpro|A0A3Q1FLK7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYVWGFDDVRDEDAANNGSVVDPPPTLVRRCHEASTGPDNESDPHLCRRLPQSDPHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTTTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q1GM98_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L10 (length=194 residues).
MSCGLWKETVVLAEDYLSLCCAGPHQAPPPPSESAAAMRRLAQDMEKQHQARFHSLTQAFLRQCGPDFCSSLRMVMEELV
EDGHLNWGRVVSLFTFTGVLARQLLEQKDTKPGLDPGKRQELGQRPVNCRGLAETIADYLGEEKKDWLLENDGWEGFCKF
SLSARKASQDLSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3Q1GS47_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L1 (length=229 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAV
KEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRI
VEWMTVYLDNHIQDWIQGQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q1GS47_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L1 (length=368 residues).
MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAPSDRRTGDSVTERRTASRESRAFVSVLAGPE
LVCQPCVGLVFTPERPVDISGPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQNRELVVFYIKYKLSQRNY
PLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAFSD
LHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQDWIQGQGG
WERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
© 1998-2019