Dataset for protein Bax of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F6YGW2_BAX-02 BCL2-associated X protein OS=[Eukaryota] Equus caballus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGDTPELGLEEVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSDFGSPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|F6YGW2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Equus caballus GN=BAX (length=197 residues).
MDGSGEQPRGGGEDRAGRMGGDTPELGLEEVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEM
FSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLGPLSPPPRRPPLRLWVT
HVADSDHLRGRSAHRLAHHLEEDGLRPPAALDCDSSA
© 1998-2019