Dataset for protein Bak1 of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|F6XWS9_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Equus caballus GN=BAK1 (length=211 residues).
MASGQGPGPPGKECGEPAPSSTSEEQVARDTEEVFRSYVYYRHQQEQEAEGAAAPADPEMDTLPLEPNSTMGQVGRQLAI
IGDDINRRYDSEFQTMLKHLQPTAENAYELFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLSQLTRFVAE
FMLHHCIARWIAQRGGWVAALDLGNGPIRNVLIVLAVVLLGQYVVRRFFKS
>gnl|bcl2dbpro|F6XWS9_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Equus caballus GN=BAK1 (length=211 residues).
MASGQGPGPPGKECGEPAPSSTSEEQVARDTEEVFRSYVYYRHQQEQEAEGAAAPADPEMDTLPLEPNSTMGQVGRQLAI
IGDDINRRYDSEFQTMLKHLQPTAENAYELFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLSQLTRFVAE
FMLHHCIARWIAQRGGWVAALDLGNGPIRNVLIVLAVVLLGQYVVRRFFKS
>gnl|bcl2dbpro|F6XWS9_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Equus caballus GN=BAK1 (length=211 residues).
MASGQGPGPPGKECGEPAPSSTSEEQVARDTEEVFRSYVYYRHQQEQEAEGAAAPADPEMDTLPLEPNSTMGQVGRQLAI
IGDDINRRYDSEFQTMLKHLQPTAENAYELFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLSQLTRFVAE
FMLHHCIARWIAQRGGWVAALDLGNGPIRNVLIVLAVVLLGQYVVRRFFKS
© 1998-2019