Dataset for protein Unclassified of organism Eptesicus fuscus gammaherpesvirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2D1A8V6_uncBAX-01 Putative BCL2-associated X protein OS=[Viruses] Eptesicus fuscus gammaherpesvirus (length=210 residues).
MADDSPVGAHIYGNLPASTTEPGENATADEPVACAAGRCIDTAEMVHALVQCFNGERSPGAPGTPLRNLVDMVADVLAAM
DDDMRAAIRALPLSQSEPLYLAVLQVLSPLVDAGAMNWGRIAAALAFLVALTHHIEQTTRQRNHPLATMAMITTSDYFKE
HAADFLQKAGGWEALKHYNKRRPMSRYAAWLATFMATLVLMFSLSRLMRR
© 1998-2019