Dataset for protein Bok of organism Epinephelus coioides

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A142K3N5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Epinephelus coioides GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGALGEISSVLLWLGDELEYLRP
NVYRNVARQLNITVASESIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKRRGGWVDVTKCVVNTDPSFRSHWLVCAVCAFGHYVKAIVLYLFREK
© 1998-2019