Dataset for protein BAX-like of organism Epinephelus coioides

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A142K3N5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Epinephelus coioides GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGALGEISSVLLWLGDELEYLRP
NVYRNVARQLNITVASESIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKRRGGWVDVTKCVVNTDPSFRSHWLVCAVCAFGHYVKAIVLYLFREK
>gnl|bcl2dbpro|A0A219P128_BAX-01 BCL2-associated X protein OS=[Eukaryota] Epinephelus coioides GN=BAX (length=192 residues).
MASHPGGGDQGKSKDDIMEVGADLLKDFIYQRVKRHGDGSTAVTREQLGGGELCDPNTKRLARCLQQIGDELDGNVELQR
MINDSSLSPTKDMFIKVAIEIFSDGRFNWGRVVALFYFACRLVIKALVTHVPDIIRTIISWTMDYLRENVINWIREQGGW
EGIRAHFGTPTWQTVGVFTAGVLTTLLVIYKM
© 1998-2019