Dataset for protein Bax of organism Epinephelus coioides

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A219P128_BAX-01 BCL2-associated X protein OS=[Eukaryota] Epinephelus coioides GN=BAX (length=192 residues).
MASHPGGGDQGKSKDDIMEVGADLLKDFIYQRVKRHGDGSTAVTREQLGGGELCDPNTKRLARCLQQIGDELDGNVELQR
MINDSSLSPTKDMFIKVAIEIFSDGRFNWGRVVALFYFACRLVIKALVTHVPDIIRTIISWTMDYLRENVINWIREQGGW
EGIRAHFGTPTWQTVGVFTAGVLTTLLVIYKM
© 1998-2019