Dataset for protein Unclassified of organism Daphnia pulex

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|E9G2H2_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Daphnia pulex (length=202 residues).
MARKIYDPNEDENSTPSDSELQIQSRELYTNFVREEIELQGLPVPDVPVLDNIQFSNPLWICNASNLRQLANEFSQSPLR
NEVRLRAQSVDLTTLNGQNFSEMIQEIFSGGTLTRERVLVVFFFCSDVALFALQNHTLNLFSKLIQWSTDYITGRFSNFI
SSQGGWTAVLNNSINTLLKVSATAACCVAVVAMLVFIRNNWK
© 1998-2019