Dataset for protein Unclassified of organism Daphnia magna

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0P4XHJ8_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Daphnia magna (length=210 residues).
MARKIYDPSENENSLSTEQGAEQIVDSQLQTQSRELYANFVREEIQLQGLPVPHVPSLDTIQFSNPLWVCNASSLRQLAN
EFSLSPLRNEVRYRAQSVDLTTLNGQNFSEMIQEVFSGGSLTKERILVVFFFCSDVALFALQNHTLNLFCKLIQWSTDYI
TGKFSNFICSQGGWTAVLNSSMNTLLKMSATAACCVAVIAMLVFIRNNWK
© 1998-2019