Dataset for protein Unclassified of organism Danio rerio

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|E7F560_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Danio rerio (length=166 residues).
MSVPSLPETQPMNDDQEQLLEQITNVILLIGDVVDRDQTIINLTDRFACVLERQHFQRLADKVFQDGITWGKIASLICIV
GKTIVKIIGNYIPDFVSWTLHYFKDNLQTWICNMGGWINSISSLARFSLELDLGSSSSMIWSSSGLLFISGMLLGGFIVW
SLIRRA
>gnl|bcl2dbpro|F1QTZ0_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Danio rerio (length=207 residues).
MACEASQDDQIGEALLIGVVRQELMEVMEVTEGNAAPPALPEAKPISNSQDQILVQQLANTIKVIGDKLDQDQAFNDMID
GLVKVADKSSFWKLVEKVFTDGQINWGRIIVLFYSVGKLSAKMVVAHLPRIVSDILSLSLDYFKRNLLQWIRTVGGWMNS
IPALACFSVDQFSGSSLRKYSPYVGVVFAFTGGLLLGGFIVSRFQKT
>gnl|bcl2dbpro|Q5EAR7_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Danio rerio (length=207 residues).
MACEASQDYQIGEALLIGVVRQELMEVMEVTEGNAAPPALPEAKPISNSQDQILVQQLANTIKVIGDKLDQDQAFNDMID
GLVKVADKSSFWKLVEKVFTDGQINWGRIIVLFYSVGKLSAKMVVARLPRIVSDILSLSLDYFKRNLLQWILTVGGWMNS
IPALACFSVDQFSGSSMRKYSPYVGVVFAFTGGLLLGGFIVSRFQKT
© 1998-2019