Dataset for protein Bok of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A0R4IZP5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=224 residues).
MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAGIGWSKPEHGSGGTLAEVSSVLLWLGDELEY
LRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHT
IVDCMGEFVRKSLASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLREK
>gnl|bcl2dbpro|A0A0R4IZP5_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=220 residues).
MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAGIGWSKPEHGSGGTLAEVSSVLLWLGDELEY
LRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTGSVCFFTGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDC
MGEFVRKSLASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLREK
>gnl|bcl2dbpro|B0S7M3_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=214 residues).
MRDMNVFARSSVLAAEMMDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEPRGVLVDVSVVLLKLGDE
LECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEF
VRRSLVPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
>gnl|bcl2dbpro|B2GRX5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=211 residues).
MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEPRGVLVDVSVVLLKLGDELEC
MRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRR
SLVPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
>gnl|bcl2dbpro|Q6DC66_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=221 residues).
MEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAGIGWSKPEHGSGGTLAEVSSVLLWLGDELEYLRP
NVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRNGHPAMVHTIVD
CMGEFVRKSLASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLREK
>gnl|bcl2dbpro|Q7T381_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=211 residues).
MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEPRGVLVDVSVVLLKLGDELEC
MRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRR
SLVPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
© 1998-2019