Dataset for protein Bcl-WAV of organism Danio rerio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D2Y5Q2_BCLWAV-01 BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Danio rerio GN=BCL-WAV (length=199 residues).
MGRSDDAVIGRGLNSPDPLVREAFLMAYDYISYVTAKPGVPLCPAPSRASAALRHAGDELLIRFPIFFRRWPRVFQDVTE
HTACPTLLSILDEHFAPTRRRDLAWSAVLSVFVLAGQLALHCQDRGMEDITPQIQECVGSYVERVICPEIRDKGGWSGFI
SRFGEKQNLEDHVVKVCCWSLLLLCVGILSYFIWTRRKT
© 1998-2019