Dataset for protein BAX-like of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A0R4IZP5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=224 residues).
MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAGIGWSKPEHGSGGTLAEVSSVLLWLGDELEY
LRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHT
IVDCMGEFVRKSLASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLREK
>gnl|bcl2dbpro|A0A0R4IZP5_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=220 residues).
MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAGIGWSKPEHGSGGTLAEVSSVLLWLGDELEY
LRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTGSVCFFTGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDC
MGEFVRKSLASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLREK
>gnl|bcl2dbpro|A9JSY8_BAX-01 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=204 residues).
MADGKNGETTDENELKGATGGEDVVDDAIIEQSAVLLRGYVIQQATIDDPNIHVSHETLGGRPQDEEDPQIKEVVDQLLK
IADDLNKNAELQHLISTVQSNCAQDVFMTVARSIFDDGINWGRVVALFHLAYRLIFQALTQNHFEIIKNIISWFLQFMKK
HISAWIRQQGGWEGIFRSMTRWRTVSTIAAVAFIVAVVYWRRTR
>gnl|bcl2dbpro|B0S7M3_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=214 residues).
MRDMNVFARSSVLAAEMMDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEPRGVLVDVSVVLLKLGDE
LECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEF
VRRSLVPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
>gnl|bcl2dbpro|B2GRX5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=211 residues).
MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEPRGVLVDVSVVLLKLGDELEC
MRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRR
SLVPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
>gnl|bcl2dbpro|D2Y5Q2_BCLWAV-01 BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Danio rerio GN=BCL-WAV (length=199 residues).
MGRSDDAVIGRGLNSPDPLVREAFLMAYDYISYVTAKPGVPLCPAPSRASAALRHAGDELLIRFPIFFRRWPRVFQDVTE
HTACPTLLSILDEHFAPTRRRDLAWSAVLSVFVLAGQLALHCQDRGMEDITPQIQECVGSYVERVICPEIRDKGGWSGFI
SRFGEKQNLEDHVVKVCCWSLLLLCVGILSYFIWTRRKT
>gnl|bcl2dbpro|I3ITC2_BAX-03 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=197 residues).
MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRIANEMEGNE
ELQGMLNSALLNPTLEHYILVVNGTFSDVTLSWGSVVALFYVACRFVVKAAEINSVDLVRSIINWTMPFIRKTCILTWIR
EQGGWGAIRSYFGTPTWQTVGVFLAGVLTVGLVLYKM
>gnl|bcl2dbpro|I3ITC2_BAX-04 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=115 residues).
MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRIANEMEGNE
ELQGMLNSALLNPTLEHYILVVNGTFSDVTLSWGC
>gnl|bcl2dbpro|Q08BX9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=204 residues).
MADGKNGETTDENELKGATGGEDVVDDAIIEQSAVLLRGYVIQQATIDDPNIHVSHETLGGRPQDEEDPQIKEVVDQLLK
IADDLNKNAELQHLISTVQSNCAQDVFMTVARSIFDDGINWGRVVALFHLAYRLIFQALTQNHLEIIKNIISWFLQFMKK
HISAWIRQQGGWEGIFRSMTRWRTVSTIAAVAFIVAVVYWRRTR
>gnl|bcl2dbpro|Q6DC66_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=221 residues).
MEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAGIGWSKPEHGSGGTLAEVSSVLLWLGDELEYLRP
NVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRNGHPAMVHTIVD
CMGEFVRKSLASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLREK
>gnl|bcl2dbpro|Q7T381_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Danio rerio GN=BOK (length=211 residues).
MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEPRGVLVDVSVVLLKLGDELEC
MRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRR
SLVPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
>gnl|bcl2dbpro|Q9I9N4_BAX-03 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=192 residues).
MAAPSGGGDTGSGNDQILDLGAALLNNFVYERVRRHGDRDAEVTRSQLGGVELCDPSHKRLAQCLQQIGDELDGNAQLQS
MLNNSNLQPTQDVFIRVAREIFSDGKFNWGRVVALFYFACRLVIKAISTRVPDIIRTIISWTMSYIQEHVINWIREQGGW
DGIRSYFGTPTWQTVGVFLAGVITTALVIRKM
© 1998-2019