Dataset for protein Bax of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A9JSY8_BAX-01 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=204 residues).
MADGKNGETTDENELKGATGGEDVVDDAIIEQSAVLLRGYVIQQATIDDPNIHVSHETLGGRPQDEEDPQIKEVVDQLLK
IADDLNKNAELQHLISTVQSNCAQDVFMTVARSIFDDGINWGRVVALFHLAYRLIFQALTQNHFEIIKNIISWFLQFMKK
HISAWIRQQGGWEGIFRSMTRWRTVSTIAAVAFIVAVVYWRRTR
>gnl|bcl2dbpro|I3ITC2_BAX-03 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=197 residues).
MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRIANEMEGNE
ELQGMLNSALLNPTLEHYILVVNGTFSDVTLSWGSVVALFYVACRFVVKAAEINSVDLVRSIINWTMPFIRKTCILTWIR
EQGGWGAIRSYFGTPTWQTVGVFLAGVLTVGLVLYKM
>gnl|bcl2dbpro|I3ITC2_BAX-04 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=115 residues).
MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRIANEMEGNE
ELQGMLNSALLNPTLEHYILVVNGTFSDVTLSWGC
>gnl|bcl2dbpro|Q08BX9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=204 residues).
MADGKNGETTDENELKGATGGEDVVDDAIIEQSAVLLRGYVIQQATIDDPNIHVSHETLGGRPQDEEDPQIKEVVDQLLK
IADDLNKNAELQHLISTVQSNCAQDVFMTVARSIFDDGINWGRVVALFHLAYRLIFQALTQNHLEIIKNIISWFLQFMKK
HISAWIRQQGGWEGIFRSMTRWRTVSTIAAVAFIVAVVYWRRTR
>gnl|bcl2dbpro|Q9I9N4_BAX-03 BCL2-associated X protein OS=[Eukaryota] Danio rerio GN=BAX (length=192 residues).
MAAPSGGGDTGSGNDQILDLGAALLNNFVYERVRRHGDRDAEVTRSQLGGVELCDPSHKRLAQCLQQIGDELDGNAQLQS
MLNNSNLQPTQDVFIRVAREIFSDGKFNWGRVVALFYFACRLVIKAISTRVPDIIRTIISWTMSYIQEHVINWIREQGGW
DGIRSYFGTPTWQTVGVFLAGVITTALVIRKM
© 1998-2019