Dataset for protein BAX-like of organism Cyprinus carpio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|X4ZER0_BAX-01 BCL2-associated X protein OS=[Eukaryota] Cyprinus carpio GN=BAX (length=198 residues).
MAAPSGGGDTGTGNDQIIALGSVLLNNFVYERVRRYGDSEAEVTRSQLGGVELCDPNHKRLGQCLQQIGDELDGNVQLQS
MVNDPALQPTQEVFMKVAREIFSDGKFNWGRVVALFYFACRLVVKAITNKIRDIIRTIISWTMSYIQEHVINWIREQGGW
NADCFYSNWDASNCSCSDVLTLPISDWLLHSEGGASCD
© 1998-2019