Dataset for protein Unclassified of organism Cyprinodon variegatus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q2CZ97_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus (length=130 residues).
DDPILEQGVVVLRGYVVERINTEDPDRHVVSEDLGGRPHELDDPEVKEVVDQLLKIADDLNRNALTTNHLENIRMVTSWV
LQVIRELLYPWLVQQGGWVGVIQSFSRWRTAIVAASVVVIATFVYYRSKR
>gnl|bcl2dbpro|A0A3Q2CZ97_uncBAX-02 Putative BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus (length=147 residues).
GVVVLRGYVVERINTEDPDRHVVSEDLGGRPHELDDPEVKEVVDQLLKIADDLNRNAEFQRNICINHTWKLFYGAPRNLG
ALTTNHLENIRMVTSWVLQVIRELLYPWLVQQGGWVGVIQSFSRWRTAIVAASVVVIATFVYYRSKR
>gnl|bcl2dbpro|A0A3Q2CZ97_uncBAX-03 Putative BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus (length=142 residues).
GVVVLRGYVVERINTEDPDRHVVSEDLGGRPHELDDPEVKEVVDQLLKIADDLNRNAEFQRQFNLSYLGKLEIHRALTTN
HLENIRMVTSWVLQVIRELLYPWLVQQGGWVGVIQSFSRWRTAIVAASVVVIATFVYYRSKR
© 1998-2019