Dataset for protein Bok of organism Cyprinodon variegatus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q2DRF3_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=213 residues).
MDVLRRSSMFASEVLDVFDRSVTEKELVSQSKALCRDYILSRLNQNGLGWSKTELNFSPSNAAVAEVSQVLLCLGDELES
IQPTLYRNVARQLNISVAMENVVSDAFLSVATEIFAAGITWGKVVAMYAVAGALAVDCVRQGHPTTVHIIVDSLGQFVRK
FLVHWLKRKGGWAEIMKCVVKMDCTPERPWLSSVMDSFKYFLTTVYVYIMKEQ
>gnl|bcl2dbpro|A0A3Q2EB70_BOK-03 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLHRAGVGWSKAEQGSAAAGGKLAEVSAVVQWLGDELEYLRP
NVYRNVARQLNISVAIEGVVSDAFMAIAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
PWLKKRGGWADITKCVVNTSPPFYSHWLVSAVFAFGHYLKAVVLYLLREK
>gnl|bcl2dbpro|A0A3Q2EB70_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=422 residues).
MVEEERRLATLTYDTLRFGEFEDFPETSEPVWILGKEYNALTEKDEILSDVTSRLWFTYRKNFPPIGGTGPTSDTGWGCM
LRCGQMILGEALMCRHLGRDWRWAREQKQREEYISILNAFIDKKDSYYSIHQIGELSSSELCALPLTGFHSTVFVVSAAA
QMGVGEGKPIGQWYGPNTVAQVLKKLAVFDTWSRLVVHVAMDNTVIIEEIKRLCMPWLDLAGEAEGEAEVNGCLEGACAL
AEEEAALWRPLVLLIPLRLGLSDINEAYIETLKQCFMLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPSED
GQVPDETYHCQHPPCRMHICELDPSIAAGFFCQTEDDFDDWCLRIRRLSCKKGGLPMFELVDSQPVHMVSVDALNLTPDF
SDSDRLERFFDSEDEEFEILSL
>gnl|bcl2dbpro|A0A3Q2EB70_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLHRAGVGWSKAEQGSAAAGGKLAEVSAVVQWLGDELEYLRP
NVYRNVARQLNISVAIEGVVSDAFMAIAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
PWLKKRGGWADITKCVVNTSPPFYSHWLVSAVFAFGHYLKAVVLYLLREK
© 1998-2019