Dataset for protein BAX-like of organism Cyprinodon variegatus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3Q2DRF3_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=213 residues).
MDVLRRSSMFASEVLDVFDRSVTEKELVSQSKALCRDYILSRLNQNGLGWSKTELNFSPSNAAVAEVSQVLLCLGDELES
IQPTLYRNVARQLNISVAMENVVSDAFLSVATEIFAAGITWGKVVAMYAVAGALAVDCVRQGHPTTVHIIVDSLGQFVRK
FLVHWLKRKGGWAEIMKCVVKMDCTPERPWLSSVMDSFKYFLTTVYVYIMKEQ
>gnl|bcl2dbpro|A0A3Q2DXF3_BAX-03 BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus GN=BAX (length=198 residues).
SFIQTLQCCGASYLQMCLICTLYSLQMFSSFVVKWIQRHALSKVPILQEALGVTALCDPQQQKVSDAFQVVADEVDGEGG
IKKLIEVPSFTPSKEVFVKIVRELFSDGEINWGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFREKVLGWIKEQ
GGWEGIFSYVGIPMWQFLGIFLAGVVTTLVVVHKMRAE
>gnl|bcl2dbpro|A0A3Q2DXF3_BAX-02 BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus GN=BAX (length=178 residues).
MLASHTSQERVSSILCLNNTSIFVVKWIQRHALSKVPILQEALGVTALCDPQQQKVSDAFQVVADEVPSFTPSKEVFVKI
VRELFSDGEINWGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFREKVLGWIKEQGGWEGIFSYVGIPMWQFLGI
FLAGVVTTLVVVHKMRAE
>gnl|bcl2dbpro|A0A3Q2DXF3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus GN=BAX (length=173 residues).
MCLICTLYSLQMFSSFVVKWIQRHALSKVPILQEALGVTALCDPQQQKVSDAFQVVADEVPSFTPSKEVFVKIVRELFSD
GEINWGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFREKVLGWIKEQGGWEGIFSYVGIPMWQFLGIFLAGVVT
TLQTKKLMGGFTE
>gnl|bcl2dbpro|A0A3Q2E537_BAX-01 BCL2-associated X protein OS=[Eukaryota] Cyprinodon variegatus GN=BAX (length=191 residues).
MAEGGGGDQGNPVDPMVEVGAVLLKDFIYQRIRRHVDGDTDVTREQLGATELCDPNHLKLAQCLQQIGDELDGNMELQRM
IEDSALKPTKDVFMKVALQIFSDGRFNWGRVVALFYFACRLVIKALITKIPEIIRTIINWTIDYIRDHVINWIREQGGWE
GIRSYFGTPTWQTVGVFLAGVLATVFVMRKM
>gnl|bcl2dbpro|A0A3Q2EB70_BOK-03 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLHRAGVGWSKAEQGSAAAGGKLAEVSAVVQWLGDELEYLRP
NVYRNVARQLNISVAIEGVVSDAFMAIAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
PWLKKRGGWADITKCVVNTSPPFYSHWLVSAVFAFGHYLKAVVLYLLREK
>gnl|bcl2dbpro|A0A3Q2EB70_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=422 residues).
MVEEERRLATLTYDTLRFGEFEDFPETSEPVWILGKEYNALTEKDEILSDVTSRLWFTYRKNFPPIGGTGPTSDTGWGCM
LRCGQMILGEALMCRHLGRDWRWAREQKQREEYISILNAFIDKKDSYYSIHQIGELSSSELCALPLTGFHSTVFVVSAAA
QMGVGEGKPIGQWYGPNTVAQVLKKLAVFDTWSRLVVHVAMDNTVIIEEIKRLCMPWLDLAGEAEGEAEVNGCLEGACAL
AEEEAALWRPLVLLIPLRLGLSDINEAYIETLKQCFMLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPSED
GQVPDETYHCQHPPCRMHICELDPSIAAGFFCQTEDDFDDWCLRIRRLSCKKGGLPMFELVDSQPVHMVSVDALNLTPDF
SDSDRLERFFDSEDEEFEILSL
>gnl|bcl2dbpro|A0A3Q2EB70_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Cyprinodon variegatus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLHRAGVGWSKAEQGSAAAGGKLAEVSAVVQWLGDELEYLRP
NVYRNVARQLNISVAIEGVVSDAFMAIAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
PWLKKRGGWADITKCVVNTSPPFYSHWLVSAVFAFGHYLKAVVLYLLREK
© 1998-2019