Dataset for protein Unclassified of organism Cynoglossus semilaevis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8W1D5_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Cynoglossus semilaevis (length=200 residues).
MSCEGNGMSDERIGTALIKVVIEEELKDVPSEDVPPLTPLVVDVTSEQERKIVSQLGVMCRIIGDRMRDDTEFQDAIDGV
VQCSGFKWDRFKQVAEKVFEQGITWERIAVLFYVAGKLALKMVEVHLPQSVREILMWTVDFFKNNLLSWIREHGGWINSF
SSLAVASMPGVSSISSFTAFILIFITGVTLGSFITWRLTR
© 1998-2019