Dataset for protein BAX-like of organism Cynoglossus semilaevis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8VGS5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cynoglossus semilaevis GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYINSRLNRVGMGWTSPEHGLASSSGTMREISSVLLWLGDELEYLRP
NVYRNVARQLNITVASESVVSDAFLAVAADIFSTGITWGKVVSLYAVAGALAVDCVRHGHPSIVHTIVDCMGEFVRKSLT
SWLKKRGGWMDVTKCVVNTDPRFSSHWLVMAACTFGHYVKTIVLYLLREK
>gnl|bcl2dbpro|A0A3P8WH41_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cynoglossus semilaevis GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKDLVSQSKALCRDYILFRLNQNGLGWSKSELNLVPSNAALAEVSSVLLCLGDELEC
LQPSLYRNVARQLSISVAMENMVSDAFIGVSTEIFATGITWGKVVAMYAVAAALAVDCVRQDRAANVNIIVQSLGQFVRK
FLVSWLKRRGGWGDITKCVVKKDFPPEQNWLTSVMESLKYFLTTVYVYIMKEP
>gnl|bcl2dbpro|A0A3P8X0F2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Cynoglossus semilaevis GN=BAX (length=192 residues).
MAAHPGGDDDGTNRDQLLELGRILLKDFIYERVQRNRDSNAVVTRSQLGAGELCDPNHKKLAQCLQQIGDELDGNVELQR
MIENSSLSPTREVFMRVAYEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDIIRTIINWTVDYLRENVINWIMEQGGW
EGIRSYFGTPTWQTVGVFLAGVLTTVIVIRKM
© 1998-2019