Dataset for protein Unclassified of organism Ctenopharyngodon idella

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M3U1E0_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Ctenopharyngodon idella (length=205 residues).
MACEVSQDDQIGEALLIRVVRHEVMSVAAEGNAAPPALPEDQPISNSQDQMLVQQLAETIKVIGDRLDQDKTFNDMIDGL
VKVADKSSFWKLVEKVFTDGQINWGRIIVLFYSVGKLSAKMVLARLPRIVSDILTLCLDYFRRNLLEWIRKVGGWMHSIP
ALACFSFEQFSGSSLRKYFPYFGAMFSFTCGLLLGGFIITRLQKS
© 1998-2019