Dataset for protein BAX-like of organism Ctenopharyngodon idella

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M5LPU0_BAX-01 BCL2-associated X protein OS=[Eukaryota] Ctenopharyngodon idella GN=BAX (length=192 residues).
MAAPSGGGDTGIGNDQILALGSALLNNFIYERVRRHGDGDAEVTRDQLGGVELCDPSHKRLAQCLQQIGDELDGNMQLQR
MLNDSALQPTQDVFMRVAREIFSDGKFNWGRVVALFYFACRLVIKAISTKIPDIIRTIISWTMSYIQEHVINWIREQGGW
EGIRSYFGTPTWQTIGVFLAGVLTTVVVIRKM
© 1998-2019