Dataset for protein Bax of organism Crassostrea hongkongensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0C5DGQ6_BAX-01 BCL2-associated X protein OS=[Eukaryota] Crassostrea hongkongensis GN=BAX (length=207 residues).
MTSSDSFRPFVKEPSGVTRQLSKDEVGQQARVLLLNQFIQDRLATERSEEQVLHMEDLQDPGTPTGPPLEYVREIGRALR
CIGDELDRNEQIQNLCDQVNPSANHETFFNVANSFFADGVYNWGRVGCLFYFAYKMAVKALSKINLIRSIVNWVVNFITD
YVAGWIIDRGGWDAIIEYFGTPQNQFFGVVGLGLTVCAGLYLLKALK
© 1998-2019