Dataset for protein Bak1 of organism Crassostrea hongkongensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0C5DYM0_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Crassostrea hongkongensis GN=BAK1 (length=232 residues).
MAYWDGGSGTRGGGRVPPSSDVRQIPSPSEQMTPDTEENVIDEAEDVIRNFIFESYQHQLTEEVDTLDSTTPQVPELCAF
TSDPMSRASQVGRQLARIGDDINRRYADEFKDMINQLNVNEDTAYEVFAGVAKKLFADEINWGRVAALMCLAYRITMTVV
KEKAKKFAQFMKVIVSHVVRFIKEKIAGWIASQGGWSAALQYSPSMSFTSLSIVVGSCLAAIAAVFYFSKKS
© 1998-2019